MCM4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MCM4 antibody: synthetic peptide directed towards the C terminal of human MCM4. Synthetic peptide located within the following region: KEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRAL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	95 kDa
Gene Name	minichromosome maintenance complex component 4
Database Link	NP_877423 Entrez Gene 4173 Human UniProt ID P33991
Background	The protein encoded byThis gene is one ofThe highly conserved mini-chromosome maintenance proteins (MCM) that are essential forThe initiation of eukaryotic genome replication.The hexameric protein complex formed by MCM proteins is a key component ofThe pre-replication complex (pre_RC) and may be involved inThe formation of replication forks and inThe recruitment of other DNA replication related proteins.The MCM complex consisting ofThis protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme.The phosphorylation ofThis protein by CDC2 kinase reducesThe DNA helicase activity and chromatin binding ofThe MCM complex.This gene is mapped to a region onThe chromosome 8 head-to-head next toThe PRKDC/DNA-PK, a DNA-activated protein kinase involved inThe repair of DNA double-strand breaks. Alternatively spliced transcript variants encodingThe same protein have been reported. [provided by RefSeq, Jul 2008]
Synonyms	CDC21; CDC54; hCdc21; NKCD; NKGCD; P1-CDC21
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 86%
Reference Data
Protein Families	Stem cell - Pluripotency, Transcription Factors
Protein Pathways	Cell cycle, DNA replication

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.