MCM3 Rabbit Polyclonal Antibody

CAT#: TA341683

Rabbit Polyclonal Anti-MCM3 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of minichromosome maintenance complex component 3 (MCM3)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human minichromosome maintenance complex component 3 (MCM3), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human minichromosome maintenance complex component 3 (MCM3), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-MCM3 antibody: synthetic peptide directed towards the C terminal of human MCM3. Synthetic peptide located within the following region: SQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQE
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 89 kDa
Gene Name minichromosome maintenance complex component 3
Background The protein encoded byThis gene is one ofThe highly conserved mini-chromosome maintenance proteins (MCM) that are involved inThe initiation of eukaryotic genome replication.The hexameric protein complex formed by MCM proteins is a key component ofThe pre-replication complex (pre_RC) and may be involved inThe formation of replication forks and inThe recruitment of other DNA replication related proteins.This protein is a subunit ofThe protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46.This protein also interacts with and is acetylated by MCM3AP, a chromatin-associated acetyltransferase.The acetylation ofThis protein inhibitsThe initiation of DNA replication and cell cycle progression. Two transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Jul 2012]
Synonyms HCC5; P1-MCM3; P1.h; RLFB
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Dog: 93%; Rabbit: 93%; Guinea pig: 93%; Mouse: 92%; Bovine: 92%
Reference Data
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
Protein Pathways Cell cycle, DNA replication
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...