GJA9 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GJA9 antibody: synthetic peptide directed towards the middle region of human GJA9. Synthetic peptide located within the following region: IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	59 kDa
Gene Name	gap junction protein alpha 9
Database Link	NP_110399 Entrez Gene 81025 Human UniProt ID P57773
Background	Connexins, such as GJA9, are involved inThe formation of gap junctions, intercellular conduits that directly connectThe cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits (Sohl et al., 2003 [PubMed 12881038]). [supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combination :: AL705385.1, AK312811.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025094 [ECO:0000348] ##Evidence-Data-END##
Synonyms	CX58; CX59; GJA10
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.