IFT140 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse, Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-IFT140 antibody: synthetic peptide directed towards the N terminal of human IFT140. Synthetic peptide located within the following region: VLRWSPSGNCLLSGDRLGVLLLWRLDQRGRVQGTPLLKHEYGKHLTHCIF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	165 kDa
Gene Name	intraflagellar transport 140
Database Link	NP_055529 Entrez Gene 106633 MouseEntrez Gene 9742 Human UniProt ID Q96RY7
Background	This gene encodes one ofThe subunits ofThe intraflagellar transport (IFT) complex A. Intraflagellar transport is involved inThe genesis, resorption and signaling of primary cilia.The primary cilium is a microtubule-based sensory organelle atThe surface of most quiescent mammalian cells, that receives signals from its environment, such asThe flow of fluid, light or odors, and transduces those signals toThe nucleus. Loss ofThe corresponding protein in mouse results in renal cystic disease. [provided by RefSeq, Jun 2012]
Synonyms	c305C8.4; c380F5.1; gs114; MZSDS; SRTD9; WDTC2
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 93%; Bovine: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.