DDX31 Rabbit Polyclonal Antibody
CAT#: TA341619
Rabbit Polyclonal Anti-DDX31 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-DDX31 antibody: synthetic peptide directed towards the N terminal of human DDX31. Synthetic peptide located within the following region: QASSEAPPAKRRNETSFLPAKKTSVKETQRTFKGNAQKMFSPKKHSVSTS |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 64 kDa |
| Gene Name | DEAD-box helicase 31 |
| Database Link | |
| Background | DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene encodes a member ofThis family.The function ofThis member has not been determined. Alternative splicing ofThis gene generates 2 transcript variants. [provided by RefSeq, Jul 2008] |
| Synonyms | PPP1R25 |
| Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 86%; Pig: 83%; Guinea pig: 83% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
