DHX32 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DHX32 antibody: synthetic peptide directed towards the N terminal of human DHX32. Synthetic peptide located within the following region: EEEGLECPNSSSEKRYFPESLDSSDGDEEEVLACEDLELNPFDGLPYSSR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	84 kDa
Gene Name	DEAH-box helicase 32 (putative)
Database Link	NP_060650 Entrez Gene 55760 Human UniProt ID Q7L7V1
Background	DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene encodes a member ofThis family.The function ofThis member has not been determined. Alternative splicing ofThis gene generates 2 transcript variants, butThe full length nature of one ofThe variants has not been defined. [provided by RefSeq, Jul 2008]
Synonyms	DDX32; DHLP1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.