DHX34 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DHX34 antibody: synthetic peptide directed towards the middle region of human DHX34. Synthetic peptide located within the following region: APQDGPPGAEEAALETLQKTSVLQRPYHCEACGKDFLFTPTEVLRHRKQH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	128 kDa
Gene Name	DEAH-box helicase 34
Database Link	NP_055496 Entrez Gene 9704 Human UniProt ID Q14147
Background	DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene encodes a member ofThis family. It is mapped toThe glioma 19q tumor suppressor region and is a tumor suppressor candidate gene. [provided by RefSeq, Jul 2008]
Synonyms	DDX34; HRH1
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Mouse: 93%; Rabbit: 93%; Pig: 87%; Rat: 87%; Bovine: 87%; Guinea pig: 87%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.