DDX17 Rabbit Polyclonal Antibody
CAT#: TA341577
Rabbit Polyclonal Anti-DDX17 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 2900.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DDX17 antibody: synthetic peptide directed towards the N terminal of human DDX17. Synthetic peptide located within the following region: PKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKK |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 80 kDa |
Gene Name | DEAD-box helicase 17 |
Database Link | |
Background | DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Based onTheir distribution patterns, some members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene encodes a DEAD box protein, which is an ATPase activated by a variety of RNA species, but not by dsDNA.This protein, and that encoded by DDX5 gene, are more closely related to each other than to any other member ofThe DEAD box family.This gene can encode multiple isoforms due to both alternative splicing andThe use of alternative translation initiation codons, including a non-AUG (CUG) start codon. [provided by RefSeq, Apr 2011] |
Synonyms | P72; RH70 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 83% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |