UAP56 (DDX39B) Rabbit Polyclonal Antibody

CAT#: TA341568

Rabbit Polyclonal Anti-BAT1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human HLA-B associated transcript 1 (BAT1), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of HLA-B associated transcript 1 (BAT1), transcript variant 1
    • 100 ug

CNY 3080.00


Recombinant protein of human HLA-B associated transcript 1 (BAT1), transcript variant 2, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of HLA-B associated transcript 1 (BAT1), transcript variant 2
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-BAT1 antibody: synthetic peptide directed towards the C terminal of human BAT1. Synthetic peptide located within the following region: YDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNI
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 47 kDa
Gene Name DEAD-box helicase 39B
Background This gene encodes a member ofThe DEAD box family of RNA-dependent ATPases that mediate ATP hydrolysis during pre-mRNA splicing.The encoded protein is an essential splicing factor required for association of U2 small nuclear ribonucleoprotein with pre-mRNA, and it also plays an important role in mRNA export fromThe nucleus toThe cytoplasm.This gene belongs to a cluster of genes localized inThe vicinity ofThe genes encoding tumor necrosis factor alpha and tumor necrosis factor beta.These genes are all withinThe human major histocompatibility complex class III region. Mutations inThis gene may be associated with rheumatoid arthritis. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on both chromosomes 6 and 11. Read-through transcription also occurs betweenThis gene andThe upstream ATP6V1G2 (ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2) gene. [provided by RefSeq, Feb 2011]
Synonyms BAT1; D6S81E; UAP56
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Pathways Spliceosome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...