UPF1 Rabbit Polyclonal Antibody
CNY 5250.00
Cited in 1 publication. |
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-UPF1 antibody: synthetic peptide directed towards the middle region of human UPF1. Synthetic peptide located within the following region: RGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 123 kDa |
Gene Name | UPF1, RNA helicase and ATPase |
Database Link | |
Background | This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream fromThe last exon-exon junction,This triggers NMD to degrade mRNAs containing premature stop codons.This protein is located only inThe cytoplasm. When translation ends, it interacts withThe protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted forThis gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Synonyms | HUPF1; NORF1; pNORF1; RENT1; smg-2 |
Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Zebrafish: 83%; Pig: 79%; Guinea pig: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
UPF1 silenced cellular model systems for screening of read-through agents active on β039 thalassemia point mutation
,null,
BMC Biotechnology
,PubMed ID 29764417
[UPF1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |