UPF1 Rabbit Polyclonal Antibody

CAT#: TA341559

Rabbit Polyclonal Anti-UPF1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Cited in 1 publication.

Product images

推荐一起购买 (4)
Transient overexpression lysate of UPF1 regulator of nonsense transcripts homolog (yeast) (UPF1)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human UPF1 regulator of nonsense transcripts homolog (yeast) (UPF1), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human UPF1 regulator of nonsense transcripts homolog (yeast) (UPF1), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-UPF1 antibody: synthetic peptide directed towards the middle region of human UPF1. Synthetic peptide located within the following region: RGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQG
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 123 kDa
Gene Name UPF1, RNA helicase and ATPase
Background This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream fromThe last exon-exon junction,This triggers NMD to degrade mRNAs containing premature stop codons.This protein is located only inThe cytoplasm. When translation ends, it interacts withThe protein that is a functional homolog of yeast Upf2p to trigger mRNA decapping. Use of multiple polyadenylation sites has been noted forThis gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Synonyms HUPF1; NORF1; pNORF1; RENT1; smg-2
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Zebrafish: 83%; Pig: 79%; Guinea pig: 79%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Customer Reviews 
Loading...