Zinc finger protein 30 (ZNF30) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF30 antibody: synthetic peptide directed towards the middle region of human ZNF30. Synthetic peptide located within the following region: YECKECGKAFSTSSPLAKHQRIHTGEKPYECKECGKSFTVYGQLTRHQSI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	71 kDa
Gene Name	zinc finger protein 30
Database Link	NP_919306 Entrez Gene 90075 Human UniProt ID P17039
Background	May be involved in transcriptional regulation.
Synonyms	KOX28
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 91%; Rat: 91%; Bovine: 91%; Mouse: 86%; Zebrafish: 86%; Dog: 83%; Rabbit: 83%; Guinea pig: 83%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.