ZNF778 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF778 antibody: synthetic peptide directed towards the N terminal of human ZNF778. Synthetic peptide located within the following region: ARSHNGGQLCDRTQCGEAFSEHSGLSTHVRTQNTGDSCVSNHYERDFFIP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	82 kDa
Gene Name	zinc finger protein 778
Database Link	NP_872337 Entrez Gene 197320 Human UniProt ID Q96MU6
Background	The protein encoded byThis gene is a member ofThe krueppel C2H2-type zinc-finger protein family, and it contains one KRAB domain and eighteen C2H2-type zinc fingers.This gene is a candidate gene for autism and variable cognitive impairment inThe 16q24.3 microdeletion syndrome. Alternatively spliced transcript variants have been found forThis gene. [provided by RefSeq, Jan 2011]
Synonyms	FLJ31875; MGC150573
Note	Immunogen Sequence Homology: Human: 100%; Yeast: 79%; Rat: 77%; Horse: 77%; Mouse: 77%; Bovine: 77%; Rabbit: 77%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.