Rex1 (ZFP42) Rabbit Polyclonal Antibody
CAT#: TA341524
Rabbit Polyclonal Anti-ZFP42 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZFP42 antibody: synthetic peptide directed towards the N terminal of human ZFP42. Synthetic peptide located within the following region: MSQQLKKRAKTRHQKGLGGRAPSGAKPRQGKSSQDLQAEIEPVSAVWALC |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 35 kDa |
Gene Name | ZFP42 zinc finger protein |
Database Link | |
Background | Involved inThe reprogramming of X-chromosome inactivation duringThe acquisition of pluripotency. Required for efficient elongation of TSIX, a non-coding RNA antisense to XIST. Binds DXPas34 enhancer withinThe TSIX promoter. Involved in ES cell self-renewal. |
Synonyms | REX-1; REX1; zfp-42; ZNF754 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Adult stem cells, Embryonic stem cells, ES Cell Differentiation/IPS, Stem cell - Pluripotency |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |