ZNF641 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF641 antibody: synthetic peptide directed towards the middle region of human ZNF641. Synthetic peptide located within the following region: CGIVVSLRFPIPKLDMLSQLEGGEEQWVPDPQDLEERDILRVTYTGGGSE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	zinc finger protein 641
Database Link	NP_689533 Entrez Gene 121274 Human UniProt ID Q96N77
Background	ZNF641 is a transcriptional activatior. It activates transcriptional activities of SRE and AP-1.
Synonyms	DKFZp667D1012; FLJ31295
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 93%; Bovine: 92%; Mouse: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.