TGIF2LX Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TGIF2LX antibody: synthetic peptide directed towards the middle region of human TGIF2LX. Synthetic peptide located within the following region: KVKVSVTSPSSPELVSPEEHADFSSFLLLVDAAVQRAAELELEKKQEPNP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	TGFB induced factor homeobox 2 like, X-linked
Database Link	NP_620410 Entrez Gene 90316 Human UniProt ID Q8IUE1
Background	This gene encodes a member ofThe TALE/TGIF homeobox family of transcription factors. Testis-specific expression suggests thatThis gene may play a role in spermatogenesis. A homolog ofThis gene lies withinThe male specific region of chromosome Y, in a block of sequence that is thought to beThe result of a large X-to-Y transposition. [provided by RefSeq, Jul 2008]
Synonyms	TGIFLX
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Dog: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.