DMRTB1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DMRTB1 antibody: synthetic peptide directed towards the middle region of human DMRTB1. Synthetic peptide located within the following region: LGYLDAPPGVPLQQGFRHVSRSQYQGGGLVSEPGGDFQPSYYLPPPPPPL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	DMRT like family B with proline rich C-terminal 1
Database Link	NP_149056 Entrez Gene 63948 Human UniProt ID Q96MA1
Background	Located on chromosome 1,This gene encodes forThe DMRT-like family B with proline-rich C-terminal, 1 protein.
Synonyms	1; DMRT-like family B with proline-rich C-terminal; FLJ40434; OTTHUMP00000009751
Note	Immunogen Sequence Homology: Human: 100%; Horse: 92%; Bovine: 86%; Dog: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.