Cyclin B3 (CCNB3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CCNB3 antibody: synthetic peptide directed towards the N terminal of human CCNB3. Synthetic peptide located within the following region: MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	cyclin B3
Database Link	NP_391990 Entrez Gene 85417 Human UniProt ID Q8WWL7
Background	The protein encoded byThis gene belongs toThe highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughThe cell cycle. Cyclins function as positive regulators of cyclin-dependent kinases (CDKs), andThereby play an essential role inThe control ofThe cell cycle. Different cyclins exhibit distinct expression and degradation patterns, which contribute toThe temporal coordination of each mitotic event. Studies of similar genes in chicken and drosophila suggest thatThis cyclin may associate with CDC2 and CDK2 kinases, and may be required for proper spindle reorganization and restoration ofThe interphase nucleus. Alternatively spliced transcript variants encoding different isoforms have been described forThis gene. [provided by RefSeq, Oct 2011]
Synonyms	cyclin B3; OTTHUMP00000023292; OTTHUMP00000023293
Note	Immunogen Sequence Homology: Human: 100%; Dog: 82%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Cell cycle, p53 signaling pathway, Progesterone-mediated oocyte maturation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.