ZNF566 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF566 antibody: synthetic peptide directed towards the middle region of human ZNF566. Synthetic peptide located within the following region: VFTHEDLPTLSHHPSFTLQQIINSKKKFCASKEYRKTFRHGSQFATHEII
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	zinc finger protein 566
Database Link	NP_116227 Entrez Gene 84924 Human UniProt ID Q969W8
Background	May be involved in transcriptional regulation.
Synonyms	FLJ14779; MGC12515
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 87%; Bovine: 87%; Dog: 80%; Rat: 80%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.