QRX (RAX2) Rabbit Polyclonal Antibody
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RAXL1 antibody: synthetic peptide directed towards the N terminal of human RAXL1. Synthetic peptide located within the following region: MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASH |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 20 kDa |
Gene Name | retina and anterior neural fold homeobox 2 |
Database Link | |
Background | This gene encodes a homeodomain-containing protein that plays a role in eye development. Mutation ofThis gene causes age-related macular degeneration type 6, an eye disorder resulting in accumulations of protein and lipid beneathThe retinal pigment epithelium and withinThe Bruch's membrane. Defects inThis gene can also cause cone-rod dystrophy type 11, a disease characterized byThe initial degeneration of cone photoreceptor cells and resulting in loss of color vision and visual acuity, followed byThe degeneration of rod photoreceptor cells, which progresses to night blindness andThe loss of peripheral vision. [provided by RefSeq, Jul 2008] |
Synonyms | ARMD6; CORD11; QRX; RAXL1 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Dog: 85% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |