ZNF557 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF557 antibody: synthetic peptide directed towards the middle region of human ZNF557. Synthetic peptide located within the following region: GKAFGTRSSLSSHYSIHTGEYPYECHDCGRTFRRRSNLTQHIRTHTGEKP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	zinc finger protein 557
Database Link	NP_077317 Entrez Gene 79230 Human UniProt ID Q8N988
Background	May be involved in transcriptional regulation.
Synonyms	FLJ96454; MGC4054
Note	Immunogen Sequence Homology: Human: 100%; Dog: 77%; Pig: 77%; Rat: 77%; Horse: 77%; Mouse: 77%; Bovine: 77%; Guinea pig: 77%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.