SPATA5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SPATA5 antibody: synthetic peptide directed towards the middle region of human SPATA5. Synthetic peptide located within the following region: ALLALEEDIQANLIMKRHFTQALSTVTPRIPESLRRFYEDYQEKSGLHTL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	98 kDa
Gene Name	spermatogenesis associated 5
Database Link	NP_660208 Entrez Gene 166378 Human UniProt ID Q8NB90
Background	SPATA5 may be involved in morphological and functional mitochondrial transformations during spermatogenesis.
Synonyms	AFG2; EHLMRS; SPAF
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.