TEKT4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TEKT4 antibody: synthetic peptide directed towards the N terminal of human TEKT4. Synthetic peptide located within the following region: LATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	tektin 4
Database Link	NP_653306 Entrez Gene 150483 Human UniProt ID Q8WW24
Background	TEKT4 belongs to the tektin family.TEKT4 is a structural component of ciliary and flagellar microtubules. It forms filamentous polymers in the walls of ciliary and flagellar microtubules.
Synonyms	MGC27019
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 93%; Pig: 92%; Guinea pig: 92%; Mouse: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.