TMEM42 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TMEM42 antibody: synthetic peptide directed towards the N terminal of human TMEM42. Synthetic peptide located within the following region: MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMRRRFWGVFNCLCAGAFG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	17 kDa
Gene Name	transmembrane protein 42
Database Link	NP_653239 Entrez Gene 131616 Human UniProt ID Q69YG0
Background	The function of this protein remains unknown.
Synonyms	MGC29956
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Pig: 85%; Guinea pig: 85%; Dog: 83%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.