C14orf148 (NOXRED1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NOXRED1 antibody: synthetic peptide directed towards the middle region of human NOXRED1. Synthetic peptide located within the following region: KLLLNHTNILRPQYQYDEDSVSVWGANKGVIAALQDPTILQATCPYSPAG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	NADP-dependent oxidoreductase domain containing 1
Database Link	NP_001106946 Entrez Gene 122945 Human UniProt ID Q6NXP6
Background	The function of this protein remains unknown.
Synonyms	C14orf148
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 85%; Bovine: 85%; Pig: 77%; Guinea pig: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.