MDP1 Rabbit Polyclonal Antibody
CAT#: TA340302
Rabbit Polyclonal Anti-MDP-1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MDP-1 antibody: synthetic peptide directed towards the N terminal of human MDP-1. Synthetic peptide located within the following region: MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 20 kDa |
Gene Name | magnesium-dependent phosphatase 1 |
Database Link | |
Background | MDP-1 is a magnesium-dependent phosphatase which may act as a tyrosine phosphatase. |
Synonyms | FN6PASE; MDP-1 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Yeast: 92%; Zebrafish: 92%; Goat: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |