Wdr92 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Wdr92 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NMEPAQGENKRDCWTVAFGNAYNQEERVVCAGYDNGDIKLFDLRNMSLRW
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	WD repeat domain 92
Database Link	NP_849240 Entrez Gene 103784 Mouse UniProt ID Q8BGF3
Background	Wdr92 seems to act as a modulator of apoptosis.
Synonyms	FLJ31741; LOC116143; Monad
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 93%; Yeast: 91%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.