ACTRT1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ACTRT1 antibody: synthetic peptide directed towards the middle region of human ACTRT1. Synthetic peptide located within the following region: DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	actin related protein T1
Database Link	NP_612146 Entrez Gene 139741 Human UniProt ID Q8TDG2
Background	The specific function of ACTRT1 is not yet known.
Synonyms	AIP1; ARIP1; ARPT1; HSD27
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Bovine: 92%; Pig: 86%; Rat: 86%; Mouse: 86%; Horse: 85%; Rabbit: 85%; Guinea pig: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.