ANKS3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ANKS3 antibody: synthetic peptide directed towards the N terminal of human ANKS3. Synthetic peptide located within the following region: WHGLGTQVSGEELDVPLDLHTAASIGQYEVVKECVQRRELDLNKKNGGGW
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	72 kDa
Gene Name	ankyrin repeat and sterile alpha motif domain containing 3
Database Link	NP_597707 Entrez Gene 124401 Human UniProt ID Q6ZW76
Background	ANKS3 contains 1 SAM (sterile alpha motif) domain and 6 ANK repeats. The exact function of ANKS3 remains unknown.
Synonyms	FLJ32345; FLJ32767; KIAA1977
Note	Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Dog: 86%; Pig: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.