DEDD2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DEDD2 antibody: synthetic peptide directed towards the middle region of human DEDD2. Synthetic peptide located within the following region: PQQQSEPARPSSEGKVTCDIRLRVRAEYCEHGPALEQGVASRRPQALARQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36
Gene Name	death effector domain containing 2
Database Link	NP_579874 Entrez Gene 162989 Human UniProt ID Q8WXF8
Background	DEDD2 may play a critical role in death receptor-induced apoptosis and may target CASP8 and CASP10 to the nucleus. DEDD2 may regulate degradation of intermediate filaments during apoptosis. DEDD2 may play a role in the general transcription machinery in the nucleus and might be an important regulator of the activity of GTF3C3.
Synonyms	FLAME-3; FLAME3
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.