DNAAF4 Rabbit Polyclonal Antibody
CAT#: TA340262
Rabbit Polyclonal Anti-DYX1C1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DYX1C1 antibody: synthetic peptide directed towards the C terminal of human DYX1C1. Synthetic peptide located within the following region: FATENYLAAINAYNLAIRLNNKMPLLYLNRAACHLKLKNLHKAIEDSSKA |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 48 kDa |
Gene Name | dyslexia susceptibility 1 candidate 1 |
Database Link | |
Background | DYX1C1contains 1 CS domain and 3 TPR repeats. A chromosomal aberration, translocation t(2;15)(q11;q21), involving DYX1C1 may be a cause of dyslexia. |
Synonyms | CILD25; DNAAF4; DYX1; DYXC1; EKN1; RD |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |