MOBKL2A (MOB3A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MOB3A antibody: synthetic peptide directed towards the middle region of human MOB3A. Synthetic peptide located within the following region: EYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNVGTPFPKN
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	MOB kinase activator 3A
Database Link	NP_570719 Entrez Gene 126308 Human UniProt ID Q96BX8
Background	MOB3A may regulate the activity of kinases.
Synonyms	MOB-LAK; MOB1C; MOBKL2A; moblak
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Horse: 93%; Mouse: 93%; Bovine: 93%; Dog: 86%; Zebrafish: 86%; Pig: 80%; Guinea pig: 80%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.