NEU4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NEU4 antibody: synthetic peptide directed towards the N terminal of human NEU4. Synthetic peptide located within the following region: TGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	neuraminidase 4 (sialidase)
Database Link	NP_542779 Entrez Gene 129807 Human UniProt ID Q8WWR8
Background	NEU4 belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids.This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids.
Synonyms	FLJ35928; MGC18222; MGC102757
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Guinea pig: 93%
Reference Data
Protein Pathways	Other glycan degradation, Sphingolipid metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.