Placental lactogen (CSH2) Rabbit Polyclonal Antibody

CAT#: TA340196

Rabbit Polyclonal Anti-CSH2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human chorionic somatomammotropin hormone 2 (CSH2), transcript variant 3, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of chorionic somatomammotropin hormone 2 (CSH2), transcript variant 2
    • 100 ug

CNY 3080.00


Recombinant protein of human chorionic somatomammotropin hormone 2 (CSH2), transcript variant 3, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CSH2 antibody: synthetic peptide directed towards the middle region of human CSH2. Synthetic peptide located within the following region: LFDHAMLQAHRAHQLAIDTYQEFRLEDGSRRTGQILKQTYSKFDTNSHNH
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 14
Gene Name chorionic somatomammotropin hormone 2
Background The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, while the ratio of 1 to 2 increases by term. Structural and expression differences provide avenues for developmental regulation and tissue specificity.
Synonyms CS-2; CSB; hCS-B; PL
Note Immunogen Sequence Homology: Human: 100%; Goat: 90%; Sheep: 90%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 79%; Rabbit: 79%; Guinea pig: 79%
Reference Data
Protein Families Secreted Protein
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...