Calpain 11 (CAPN11) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CAPN11 antibody: synthetic peptide directed towards the N terminal of human CAPN11. Synthetic peptide located within the following region: NNSRLKAKGVGQHDNAQNFGNQSFEELRAACLRKGELFEDPLFPAEPSSL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	80 kDa
Gene Name	calpain 11
Database Link	NP_008989 Entrez Gene 11131 Human UniProt ID Q9UMQ6
Background	Calpains constitute a family of intracellular calcium-dependent cysteine proteases. There are eight members in this superfamily. They consist of a variable 80 kDa subunit and an invariant 30 kDa subunit. This calpain protein appears to have protease activity and calcium-binding ability. A similar mouse protein may play a functional role in spermatogenesis and in the regulation of calcium-dependent signal transduction events during meiosis.
Synonyms	calpain11
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 92%; Rat: 91%; Horse: 86%; Goat: 85%; Sheep: 85%; Bovine: 85%; Mouse: 77%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.