RFPL2 Rabbit Polyclonal Antibody
CAT#: TA340120
Rabbit Polyclonal Anti-RFPL2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RFPL2 antibody: synthetic peptide directed towards the C terminal of human RFPL2. Synthetic peptide located within the following region: VSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPPNGDQGVLSICPLMNSG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 32 kDa |
Gene Name | ret finger protein like 2 |
Database Link | |
Background | RFPL2 contains 1 B30.2/SPRY domain and 1 RING-type zinc finger. The human RFPL2 gene has a role in neocortex development. |
Synonyms | RNF79 |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 85% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |