SEC23B Rabbit Polyclonal Antibody

CAT#: TA340104

Rabbit Polyclonal Anti-SEC23B Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 2
    • 100 ug

CNY 3080.00


Recombinant protein of human Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of Sec23 homolog B (S. cerevisiae) (SEC23B), transcript variant 1
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Mouse, Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SEC23B antibody: synthetic peptide directed towards the middle region of human SEC23B. Synthetic peptide located within the following region: SFSLYPQFMFHLRRSPFLQVFNNSPDESSYYRHHFARQDLTQSLIMIQPI
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 86 kDa
Gene Name Sec23 homolog B, coat complex II component
Background SEC23B is a member of the SEC23 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. SEC23B has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The function SEC23B has been implicated in cargo selection and concentration.The protein encoded by this gene is a member of the SEC23 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The function of this gene product has been implicated in cargo selection and concentration. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
Synonyms CDA-II; CDAII; CDAN2; HEMPAS
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 92%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...