Dctn1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Dctn1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Dctn1. Synthetic peptide located within the following region: EANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQTLLRKKEKEFEETMD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	140 kDa
Gene Name	dynactin subunit 1
Database Link	NP_077044 Entrez Gene 29167 Rat UniProt ID P28023
Background	Dctn1 is a component of dynein microtubule activated ATPase, which acts as a microtubule motor.
Synonyms	DAP-150; DP-150; HMN7B; OTTHUMP00000202491; P135; p150-glued
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.