Endothelin 2 (EDN2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-EDN2 antibody: synthetic peptide directed towards the n terminal of human EDN2. Synthetic peptide located within the following region: MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	20 kDa
Gene Name	endothelin 2
Database Link	NP_001947 Entrez Gene 1907 Human UniProt ID P20800
Background	This gene encodes a member of the endothelin protein family of secretory vasoconstrictive peptides. The preproprotein is processed to a short mature form which functions as a ligand for the endothelin receptors that initiate intracellular signaling events. This gene product is involved in a wide range of biological processes, such as hypertension and ovulation.
Synonyms	ET-2; ET2; PPET2
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rat: 93%; Rabbit: 93%
Reference Data
Protein Families	Druggable Genome, Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.