CHN 1 (CHN1) Rabbit Polyclonal Antibody
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CHN1 antibody: synthetic peptide directed towards the middle region of human CHN1. Synthetic peptide located within the following region: KVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSEGLYRVSGFSDLIE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 53 kDa |
Gene Name | chimerin 1 |
Database Link | |
Background | CHN1 contains 1 phorbol-ester/DAG-type zinc finger, 1 Rho-GAP domain and 1 SH2 domain. CHN1 is a GTPase-activating protein for p21-rac and a phorbol ester receptor. It may play an important role in neuronal signal-transduction mechanisms. |
Synonyms | ARHGAP2; CHN; DURS2; NC; RHOGAP2 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Zebrafish: 86%; Yeast: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |