CHI3L1 Rabbit Polyclonal Antibody

CAT#: TA340002

Rabbit Polyclonal Anti-CHI3L1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of chitinase 3-like 1 (cartilage glycoprotein-39) (CHI3L1)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human chitinase 3-like 1 (cartilage glycoprotein-39) (CHI3L1), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human chitinase 3-like 1 (cartilage glycoprotein-39) (CHI3L1), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications IF, WB
Recommend Dilution WB, IF
Reactivity Human, SimianIVE
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CHI3L1 antibody: synthetic peptide directed towards the middle region of human CHI3L1. Synthetic peptide located within the following region: LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 42 kDa
Gene Name chitinase 3 like 1
Background CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment. CHI3L1 may play a role in tissue remodeling and defense against pathogens. It belongs to the glycosyl hydrolase 18 family. CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment.
Synonyms ASRT7; CGP-39; GP-39; GP39; HC-gp39; HCGP-3P; hCGP-39; YKL-40; YKL40; YYL-40
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 92%; Goat: 92%; Bovine: 92%; Dog: 77%; Rat: 77%
Reference Data
Protein Families Secreted Protein
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...