SLC47A2 Rabbit Polyclonal Antibody
CAT#: TA339993
Rabbit Polyclonal Anti-SLC47A2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SLC47A2 antibody: synthetic peptide directed towards the C terminal of human SLC47A2. Synthetic peptide located within the following region: TYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAALGAASATLMV |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 61 kDa |
Gene Name | solute carrier family 47 member 2 |
Database Link | |
Background | SLC47A2 is a protein belonging to a family of transporters involved in excretion of toxic electrolytes, both endogenous and exogenous, through urine and bile. This transporter family shares homology with the bacterial MATE (multidrug and toxin extrusion) protein family responsible for drug resistance.This gene encodes a protein belonging to a family of transporters involved in excretion of toxic electrolytes, both endogenous and exogenous, through urine and bile. This transporter family shares homology with the bacterial MATE (multidrug and toxin extrusion) protein family responsible for drug resistance. This gene is one of two members of the MATE transporter family located near each other on chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. |
Synonyms | MATE2; MATE2-B; MATE2-K; MATE2K |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 85%; Horse: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它SLC47A2产品