FAM54A (MTFR2) Rabbit Polyclonal Antibody
CAT#: TA339992
Rabbit Polyclonal Anti-FAM54A Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 3080.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-FAM54A antibody: synthetic peptide directed towards the middle region of human FAM54A. Synthetic peptide located within the following region: NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPGGRPIHKRKRQ |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 43 kDa |
Gene Name | mitochondrial fission regulator 2 |
Database Link | |
Background | FAM54A belongs to the MTFR1/FAM54 family. The function of the FAM54A protein is not known. |
Synonyms | DUFD1; FAM54A |
Note | Immunogen Sequence Homology: Human: 100%; Bovine: 85%; Rabbit: 83% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |