GCOM1 Rabbit Polyclonal Antibody
CAT#: TA339965
Rabbit Polyclonal Anti-Gcom1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 4840.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Gcom1 antibody: synthetic peptide directed towards the middle region of human Gcom1. Synthetic peptide located within the following region: VAQVENQLLKMKVESSQEANAEVMREMTKKLYSQYEEKLQEEQRKHSAEK |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 52 kDa |
| Gene Name | GRINL1A complex locus 1 |
| Database Link | |
| Background | This gene (Gcom1) is part of a complex transcript unit that includes the gene for glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A (GRINL1A). Transcription of this gene occurs at an upstream promoter, with two different groups of alternatively spliced variants: Gup for GRINL1A upstream transcripts and Gcom for GRINL1A combined transcripts. The GRINL1A gene uses a downstream promoter for transcription and also has multiple alternatively spliced variants. This gene (Gcom1) is part of a complex transcript unit that includes the gene for glutamate receptor, ionotropic, N-methyl D-aspartate-like 1A (GRINL1A). Transcription of this gene occurs at an upstream promoter, with two different groups of alternatively spliced variants: Gup for GRINL1A upstream transcripts and Gcom for GRINL1A combined transcripts. The GRINL1A gene uses a downstream promoter for transcription and also has multiple alternatively spliced variants. |
| Synonyms | gcom; Gcom2; GRINL1A; MYZAP; MYZAP-POLR2M |
| Note | Immunogen Sequence Homology: Human: 100%; Yeast: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 93%; Rabbit: 86%; Horse: 85%; Bovine: 85%; Dog: 77%; Zebrafish: 75% |
| Reference Data | |
| Protein Families | Druggable Genome |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
