C4orf46 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C4orf46 antibody: synthetic peptide directed towards the middle region of human LOC201725. Synthetic peptide located within the following region: VSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKLLEATSAVSAQVEEL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	12 kDa
Gene Name	chromosome 4 open reading frame 46
Database Link	NP_001008394 Entrez Gene 201725 Human UniProt ID Q504U0
Background	The specific function of LOC201725 is not yet known.
Synonyms	RCDG1
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%; Horse: 86%; Rat: 79%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.