KLHDC9 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KLHDC9 antibody: synthetic peptide directed towards the middle region of human KLHDC9. Synthetic peptide located within the following region: AEPEVAGHWSHGKIKEEPPVAPHLMEQLARLVSSGQGSQKGPHGLRHHSC
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	kelch domain containing 9
Database Link	NP_689579 Entrez Gene 126823 Human UniProt ID Q8NEP7
Background	The function of this protein remains unknown.
Synonyms	KARCA1
Note	Immunogen Sequence Homology: Human: 100%; Horse: 92%; Bovine: 85%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.