UXT Rabbit Polyclonal Antibody

CAT#: TA339896

Rabbit Polyclonal Anti-UXT Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4537.00


货期*
2周

规格
    • 100 ug

Product images

推荐一起购买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human ubiquitously-expressed transcript (UXT), transcript variant 2, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of ubiquitously-expressed transcript (UXT), transcript variant 2
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-UXT antibody: synthetic peptide directed towards the N terminal of human UXT. Synthetic peptide located within the following region: MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 19 kDa
Gene Name ubiquitously expressed prefoldin like chaperone
Background UXT is a novel protein which is highly conserved in mouse. It interacts with the N-terminus of the androgen receptor and plays a role in facilitating receptor-induced transcriptional activation. It is also likely to be involved in tumorigenesis as it is abundantly expressed in tumor tissues.This gene encodes a novel protein which is highly conserved in mouse. It interacts with the N-terminus of the androgen receptor and plays a role in facilitating receptor-induced transcriptional activation. It is also likely to be involved in tumorigenesis as it is abundantly expressed in tumor tissues. This gene is part of a gene cluster on chromosome Xp11.23. Alternative splicing results in 2 transcript variants encoding different isoforms.
Synonyms ART-27; STAP1
Note Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Goat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 86%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...