HEF1 (NEDD9) Rabbit Polyclonal Antibody
CAT#: TA339893
Rabbit Polyclonal Anti-NEDD9 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4537.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 4840.00
CNY 9998.00
CNY 3080.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NEDD9 antibody: synthetic peptide directed towards the middle region of human NEDD9. Synthetic peptide located within the following region: HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 93 kDa |
Gene Name | neural precursor cell expressed, developmentally down-regulated 9 |
Database Link | |
Background | Variation in NEDD9 is associated wih susceptibility to late-onset Alzheimer and Parkinson diseases. Changes in expression of the scaffold protein HEF1/CAS-L/NEDD9 were found to be a potent prometastatic stimulus in melanoma and other cancers. |
Synonyms | CAS-L; CAS2; CASL; CASS2; HEF1 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Mouse: 92%; Bovine: 86%; Pig: 79%; Rat: 79%; Rabbit: 79%; Guinea pig: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |