KTEL1 (POGLUT1) Rabbit Polyclonal Antibody
CAT#: TA339884
Rabbit Polyclonal Anti-POGLUT1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-POGLUT1 antibody is: synthetic peptide directed towards the N-terminal region of Human POGLUT1. Synthetic peptide located within the following region: FLLPSAQGRQKESGSKWKVFIDQINRSLENYEPCSSQNCSCYHGVIEEDL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 46 kDa |
Gene Name | protein O-glucosyltransferase 1 |
Database Link | |
Background | POGLUT1 is a UDP-glucosyltransferase. |
Synonyms | C3orf9; CLP46; hCLP46; KDELCL1; KTELC1; MDS010; MDSRP; Rumi |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Horse: 79%; Rabbit: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |