FHIT Rabbit Polyclonal Antibody
CNY 4628.00
CNY 3080.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-FHIT antibody: synthetic peptide directed towards the middle region of human FHIT. Synthetic peptide located within the following region: VHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYF |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 17 |
Gene Name | fragile histidine triad |
Database Link | |
Background | This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. Alternatively spliced transcript variants have been found for this gene. |
Synonyms | AP3Aase; FRA3B |
Note | Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Rabbit: 93%; Pig: 86%; Zebrafish: 86%; Guinea pig: 86%; Rat: 79%; Mouse: 79% |
Reference Data | |
Protein Pathways | Non-small cell lung cancer, Purine metabolism, Small cell lung cancer |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |