FAM164B (ZC2HC1B) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C6orf94 antibody: synthetic peptide directed towards the N terminal of human C6orf94. Synthetic peptide located within the following region: PICKKLFNRKRKPFSSLKQRLQGTDIPTVKKTPQSKSPPVRKSNWRQQHE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	zinc finger C2HC-type containing 1B
Database Link	NP_001013645 Entrez Gene 153918 Human UniProt ID Q5TFG8
Background	The function of C6orf94 remains unknown.
Synonyms	C6orf94; dJ468K18.5; FAM164B
Note	Immunogen Sequence Homology: Human: 100%; Pig: 79%; Rat: 79%; Bovine: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.